PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g045051m
Common NameCISIN_1g045051mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 701aa    MW: 79158.2 Da    PI: 6.3721
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g045051mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS366.53.6e-1123276963374
               GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lL+ cA+av++ d++ a+ +L+++++++sp gd +qRla+yf+++L+ rla++ + +   l++s++s    +e+l+a+k+++  +P+ +++
  orange1.1g045051m 327 TLLTLCAQAVANYDQRTANDFLKQIRQHSSPFGDGIQRLAHYFANGLEVRLAGTRTPVQTHLASSRAS---AAEVLQAYKVYVSSCPFNRMT 415
                        68999************************************************888888888877777...99******************* PP

               GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                        +++aN++Il+ +e+++r+Hi+Df+i++G+QWp+L+q +++Rp+gpp++R+T+++ p++g   +e++eetg+rL+ + +++gvpfe+n+ +a+
  orange1.1g045051m 416 FFMANRMILKLAEKATRLHIVDFGIGYGFQWPCLIQRISKRPGGPPKIRMTAIEFPQPGfkPAERVEETGHRLKCYSQRFGVPFEYNT-IAQ 506
                        **********************************************************999***************************.7** PP

               GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        ++++++le+L+++++E+++Vn+ +++ +l+d++v ++s+rd+vL+l+k+++P+++++   +  +n++ Fl rf eal ++s++fd++e+++p
  orange1.1g045051m 507 KWQNIQLEDLKIDREEMTVVNCLYRMRNLPDDTVVINSPRDAVLELIKKINPDIFIHGVVNGTYNAPFFLPRFREALFHFSTFFDMFESTVP 598
                        ******************************************************************************************** PP

               GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLv 368
                        re++ r+  Ere+ g++++nv+aceg er+er et+++W++r  +aGFk+++l++++ k++++l++      + ++e  +++++gWk+r  +
  orange1.1g045051m 599 REDQGRMIFEREIYGKDAMNVIACEGIERVERPETYKQWQARNLRAGFKQLELDKDILKTIRTLVKSNFHPDFVIDEAGEWMLQGWKGRLAY 690
                        *****************************************************************9998888******************** PP

               GRAS 369 svSaWr 374
                        ++S+W+
  orange1.1g045051m 691 ALSFWK 696
                        *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.366299676IPR005202Transcription factor GRAS
PfamPF035141.2E-109327696IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MKTLVEEFSG SMKNPLQFDR GSVSTYSNRN HVDKFKLKQS REPIDPPLPP SASLQNNQNP  60
PSDSDSSSTM SSYGDPADIC ELSNTTLKFI SEILMEEDLE GKTCMLQDCL ALQAAEKSFY  120
DVLGQKYPPS PNQISPCSSR NSETLNDYCT SGSTSVNNLF EPNWMSNQGD SSSSITQTNL  180
FNSPESVLVP NLFSTGSSFL LNDNTAIINS TSDSAKSPEG EDRTYSSPYG SRGRKYDELE  240
DSDYLEEGRS NKQSALSPPE NEPLEMYDEV VLCKCENNKS TVCLIHGYVQ NGSSGKLQQN  300
GQPKGSSSAT TRSRRKGKKS EVVDLWTLLT LCAQAVANYD QRTANDFLKQ IRQHSSPFGD  360
GIQRLAHYFA NGLEVRLAGT RTPVQTHLAS SRASAAEVLQ AYKVYVSSCP FNRMTFFMAN  420
RMILKLAEKA TRLHIVDFGI GYGFQWPCLI QRISKRPGGP PKIRMTAIEF PQPGFKPAER  480
VEETGHRLKC YSQRFGVPFE YNTIAQKWQN IQLEDLKIDR EEMTVVNCLY RMRNLPDDTV  540
VINSPRDAVL ELIKKINPDI FIHGVVNGTY NAPFFLPRFR EALFHFSTFF DMFESTVPRE  600
DQGRMIFERE IYGKDAMNVI ACEGIERVER PETYKQWQAR NLRAGFKQLE LDKDILKTIR  660
TLVKSNFHPD FVIDEAGEWM LQGWKGRLAY ALSFWKPVQD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-413296968375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.7930.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424858.10.0hypothetical protein CICLE_v10027926mg
RefseqXP_006488350.10.0PREDICTED: scarecrow-like protein 30
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A067FZQ40.0A0A067FZQ4_CITSI; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14